![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein automated matches [190888] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries) |
![]() | Domain d2rblb_: 2rbl B: [198334] automated match to d2rblm_ |
PDB Entry: 2rbl (more details), 2.1 Å
SCOPe Domain Sequences for d2rblb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rblb_ b.1.2.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ldapsqievkdvtdttalitwsmqlsqlegieltygikdvpgdrttidltedenqysign lkpdteyevslisrrgdmssnpaketftt
Timeline for d2rblb_: