SCOPe 2.03: Domain d2r56m2: 2r56 M:108-211

Lineage for d2r56m2 (2r56 M:108-211)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)

8. Domain d2r56m2: 2r56 M:108-211 [198324]
   Other proteins in same PDB: d2r56a_, d2r56b_, d2r56l1, d2r56m1
   automated match to d3fcta2
   complexed with lmt

Details for d2r56m2

PDB Entry: 2r56, 2.8 Å

PDB Description: Crystal Structure of a Recombinant IgE Fab Fragment in Complex with Bovine Beta-Lactoglobulin Allergen

PDB Compounds: (M:) IgE Fab Fragment, light chain

SCOPe Domain Sequences for d2r56m2:

Sequence; same for both SEQRES and ATOM records:

>d2r56m2 b.1.1.2 (M:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d2r56m2:

• d2r56m2 is new in SCOPe 2.03-stable
  
• d2r56m2 appears in SCOPe 2.04
  
• d2r56m2 appears in the current release, SCOPe 2.08