Lineage for d2r56m1 (2r56 M:1-107)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2367942Domain d2r56m1: 2r56 M:1-107 [198323]
    Other proteins in same PDB: d2r56a_, d2r56b_, d2r56l2, d2r56m2
    automated match to d3fcta1
    complexed with lmt

Details for d2r56m1

PDB Entry: 2r56 (more details), 2.8 Å

PDB Description: Crystal Structure of a Recombinant IgE Fab Fragment in Complex with Bovine Beta-Lactoglobulin Allergen
PDB Compounds: (M:) IgE Fab Fragment, light chain

SCOPe Domain Sequences for d2r56m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r56m1 b.1.1.0 (M:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspsslsasvgdrvtitcrasqgissrlawyqqkpgkapklliyaasslqsgvps
rfsgsgsgteftltisslqpedfatyycqqyhsypwtfgqgtkleik

SCOPe Domain Coordinates for d2r56m1:

Click to download the PDB-style file with coordinates for d2r56m1.
(The format of our PDB-style files is described here.)

Timeline for d2r56m1: