SCOPe 2.07: Domain d2r56m1: 2r56 M:1-107

Lineage for d2r56m1 (2r56 M:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d2r56m1: 2r56 M:1-107 [198323]
   Other proteins in same PDB: d2r56a_, d2r56b_, d2r56l2, d2r56m2
   automated match to d3fcta1
   complexed with lmt

Details for d2r56m1

PDB Entry: 2r56, 2.8 Å

PDB Description: Crystal Structure of a Recombinant IgE Fab Fragment in Complex with Bovine Beta-Lactoglobulin Allergen

PDB Compounds: (M:) IgE Fab Fragment, light chain

SCOPe Domain Sequences for d2r56m1:

Sequence; same for both SEQRES and ATOM records:

>d2r56m1 b.1.1.0 (M:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspsslsasvgdrvtitcrasqgissrlawyqqkpgkapklliyaasslqsgvps
rfsgsgsgteftltisslqpedfatyycqqyhsypwtfgqgtkleik

Timeline for d2r56m1:

• d2r56m1 first appeared in SCOPe 2.03
  
• d2r56m1 appears in SCOPe 2.06
  
• d2r56m1 appears in the current release, SCOPe 2.08