Lineage for d2r56l1 (2r56 L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757547Domain d2r56l1: 2r56 L:1-107 [198321]
    Other proteins in same PDB: d2r56a_, d2r56b_, d2r56h_, d2r56i_, d2r56l2, d2r56m2
    automated match to d3fcta1
    complexed with lmt

Details for d2r56l1

PDB Entry: 2r56 (more details), 2.8 Å

PDB Description: Crystal Structure of a Recombinant IgE Fab Fragment in Complex with Bovine Beta-Lactoglobulin Allergen
PDB Compounds: (L:) IgE Fab Fragment, light chain

SCOPe Domain Sequences for d2r56l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r56l1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspsslsasvgdrvtitcrasqgissrlawyqqkpgkapklliyaasslqsgvps
rfsgsgsgteftltisslqpedfatyycqqyhsypwtfgqgtkleik

SCOPe Domain Coordinates for d2r56l1:

Click to download the PDB-style file with coordinates for d2r56l1.
(The format of our PDB-style files is described here.)

Timeline for d2r56l1: