Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Fab Kau cold agglutinin (human) IgM, kappa L chain [48764] (2 PDB entries) |
Domain d1dn0c1: 1dn0 C:1-107 [19832] Other proteins in same PDB: d1dn0a2, d1dn0b2, d1dn0c2, d1dn0d2 |
PDB Entry: 1dn0 (more details), 2.28 Å
SCOP Domain Sequences for d1dn0c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dn0c1 b.1.1.1 (C:1-107) Immunoglobulin (variable domains of L and H chains) {Fab Kau cold agglutinin (human) IgM, kappa L chain} eivltqspatlslspgeratlscgasqsvssnylawyqqkpgqaprlliydassratgip drfsgsgsgtdftltisrlepedfavyycqqygsspltfgggtkvei
Timeline for d1dn0c1: