SCOP 1.55: Domain d1dn0c1: 1dn0 C:1-107

Lineage for d1dn0c1 (1dn0 C:1-107)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab Kau cold agglutinin (human) IgM, kappa L chain [48764] (2 PDB entries)

8. Domain d1dn0c1: 1dn0 C:1-107 [19832]
   Other proteins in same PDB: d1dn0a2, d1dn0b2, d1dn0c2, d1dn0d2

Details for d1dn0c1

PDB Entry: 1dn0, 2.28 Å

PDB Description: structure of the fab fragment from a human igm cold agglutinin

SCOP Domain Sequences for d1dn0c1:

Sequence; same for both SEQRES and ATOM records:

>d1dn0c1 b.1.1.1 (C:1-107) Immunoglobulin (variable domains of L and H chains) {Fab Kau cold agglutinin (human) IgM, kappa L chain}
eivltqspatlslspgeratlscgasqsvssnylawyqqkpgqaprlliydassratgip
drfsgsgsgtdftltisrlepedfavyycqqygsspltfgggtkvei

Timeline for d1dn0c1:

• d1dn0c1 appears in SCOP 1.57
  
• d1dn0c1 appears in the current release, SCOPe 2.08