Lineage for d2qwpb_ (2qwp B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1256372Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1256495Superfamily a.2.3: Chaperone J-domain [46565] (2 families) (S)
  5. 1256496Family a.2.3.1: Chaperone J-domain [46566] (8 proteins)
    Pfam PF00226
  6. 1256526Protein automated matches [226960] (1 species)
    not a true protein
  7. 1256527Species Cow (Bos taurus) [TaxId:9913] [225388] (4 PDB entries)
  8. 1256529Domain d2qwpb_: 2qwp B: [198316]
    Other proteins in same PDB: d2qwpa1, d2qwpa2
    automated match to d1nz6b_
    complexed with acy, adp, gol, mg, na, po4

Details for d2qwpb_

PDB Entry: 2qwp (more details), 1.75 Å

PDB Description: crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)r171c and bovine auxilin (810-910aa)d876c in the adp*pi form #2
PDB Compounds: (B:) Putative tyrosine-protein phosphatase auxilin

SCOPe Domain Sequences for d2qwpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qwpb_ a.2.3.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dpeklkilewiegkernirallstmhtvlwagetkwkpvgmadlvtpeqvkkvyrkavlv
vhpckatgqpyeqyakmifmelndawsefenq

SCOPe Domain Coordinates for d2qwpb_:

Click to download the PDB-style file with coordinates for d2qwpb_.
(The format of our PDB-style files is described here.)

Timeline for d2qwpb_: