![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (19 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries) |
![]() | Domain d2qqnl1: 2qqn L:1-107 [198311] Other proteins in same PDB: d2qqna_, d2qqnh1, d2qqnh2, d2qqnl2 automated match to d1rhha1 complexed with edo |
PDB Entry: 2qqn (more details), 2.2 Å
SCOPe Domain Sequences for d2qqnl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qqnl1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqmtqspsslsasvgdrvtitcrasqyfssylawyqqkpgkapklliygassrasgvps rfsgsgsgtdftltisslqpedfatyycqqylgspptfgqgtkveik
Timeline for d2qqnl1: