Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (70 species) not a true protein |
Species Klebsiella pneumoniae [195749] (2 PDB entries) |
Domain d2qpna_: 2qpn A: [198310] automated match to d2qpnb_ complexed with so4 |
PDB Entry: 2qpn (more details), 1.1 Å
SCOPe Domain Sequences for d2qpna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qpna_ e.3.1.0 (A:) automated matches {Klebsiella pneumoniae} kltfktdleklerekaaqigvaivdpqgeivaghrmaqrfamcstfkfplaalvferids gtergdrklsygpdmivewspaterflasghmtvleaaqaavqlsdngatnlllreiggp aamtqyfrkigdsvsrldrkepemgdntpgdlrdtttpiamartvakvlyggaltststh tierwlignqtgdatlragfpkdwvvgektgtcanggrndigffkaqerdyavavyttap klsaverdelvasvgqvitqlilst
Timeline for d2qpna_: