Lineage for d2qpna_ (2qpn A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3014493Species Klebsiella pneumoniae [195749] (2 PDB entries)
  8. 3014494Domain d2qpna_: 2qpn A: [198310]
    automated match to d2qpnb_
    complexed with so4

Details for d2qpna_

PDB Entry: 2qpn (more details), 1.1 Å

PDB Description: GES-1 beta-lactamase
PDB Compounds: (A:) Beta-lactamase GES-1

SCOPe Domain Sequences for d2qpna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qpna_ e.3.1.0 (A:) automated matches {Klebsiella pneumoniae}
kltfktdleklerekaaqigvaivdpqgeivaghrmaqrfamcstfkfplaalvferids
gtergdrklsygpdmivewspaterflasghmtvleaaqaavqlsdngatnlllreiggp
aamtqyfrkigdsvsrldrkepemgdntpgdlrdtttpiamartvakvlyggaltststh
tierwlignqtgdatlragfpkdwvvgektgtcanggrndigffkaqerdyavavyttap
klsaverdelvasvgqvitqlilst

SCOPe Domain Coordinates for d2qpna_:

Click to download the PDB-style file with coordinates for d2qpna_.
(The format of our PDB-style files is described here.)

Timeline for d2qpna_: