Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (22 species) not a true protein |
Species Azotobacter vinelandii [TaxId:354] [188536] (1 PDB entry) |
Domain d2qleb_: 2qle B: [198308] Other proteins in same PDB: d2qlea2 automated match to d2qled_ complexed with imd; mutant |
PDB Entry: 2qle (more details), 1.59 Å
SCOPe Domain Sequences for d2qleb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qleb_ d.22.1.1 (B:) automated matches {Azotobacter vinelandii [TaxId: 354]} geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt fgygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnri elkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhyq qntpigdgpvllpdnhylstqvalskdpnekrdhmvllefvtaagith
Timeline for d2qleb_:
View in 3D Domains from other chains: (mouse over for more information) d2qlea1, d2qlea2, d2qlec_, d2qled_ |