Lineage for d2qioc_ (2qio C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2102904Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2103489Protein Enoyl-ACP reductase [51791] (11 species)
  7. 2103490Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188487] (1 PDB entry)
  8. 2103493Domain d2qioc_: 2qio C: [198303]
    automated match to d2qiod_
    complexed with nad, tcl

Details for d2qioc_

PDB Entry: 2qio (more details), 2.44 Å

PDB Description: x-ray structure of enoyl-acyl carrier protein reductase from bacillus anthracis with triclosan
PDB Compounds: (C:) Enoyl-(Acyl-carrier-protein) reductase

SCOPe Domain Sequences for d2qioc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qioc_ c.2.1.2 (C:) Enoyl-ACP reductase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mellqgktfvvmgvanqrsiawgiarslhnagakliftyagerlernvreladtlegqes
lvlpcdvtndeeltacfetikqevgtihgvahciafanrddlkgefvdtsrdgfllaqni
safsltavareakkvmteggniltltylggervvknynvmgvakasleasvkylandlgq
hgirvnaisagpirtlsakgvgdfnsilreieeraplrrtttqeevgdtavflfsdlarg
vtgenihvdsgyhilg

SCOPe Domain Coordinates for d2qioc_:

Click to download the PDB-style file with coordinates for d2qioc_.
(The format of our PDB-style files is described here.)

Timeline for d2qioc_: