Lineage for d2qiob_ (2qio B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842037Protein Enoyl-ACP reductase [51791] (11 species)
  7. 2842038Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188487] (1 PDB entry)
  8. 2842040Domain d2qiob_: 2qio B: [198302]
    automated match to d2qiod_
    complexed with nad, tcl

Details for d2qiob_

PDB Entry: 2qio (more details), 2.44 Å

PDB Description: x-ray structure of enoyl-acyl carrier protein reductase from bacillus anthracis with triclosan
PDB Compounds: (B:) Enoyl-(Acyl-carrier-protein) reductase

SCOPe Domain Sequences for d2qiob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qiob_ c.2.1.2 (B:) Enoyl-ACP reductase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mellqgktfvvmgvanqrsiawgiarslhnagakliftyagerlernvreladtlegqes
lvlpcdvtndeeltacfetikqevgtihgvahciafanrddlkgefvdtsrdgfllaqni
safsltavareakkvmteggniltltylggervvknynvmgvakasleasvkylandlgq
hgirvnaisagpirtlsakgvgdfnsilreieeraplrrtttqeevgdtavflfsdlarg
vtgenihvdsgyhilg

SCOPe Domain Coordinates for d2qiob_:

Click to download the PDB-style file with coordinates for d2qiob_.
(The format of our PDB-style files is described here.)

Timeline for d2qiob_: