Lineage for d2qazc_ (2qaz C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1336080Fold b.136: SspB-like [101737] (1 superfamily)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold
  4. 1336081Superfamily b.136.1: SspB-like [101738] (3 families) (S)
  5. 1336119Family b.136.1.0: automated matches [191484] (1 protein)
    not a true family
  6. 1336120Protein automated matches [190776] (1 species)
    not a true protein
  7. 1336121Species Caulobacter vibrioides [TaxId:155892] [188004] (1 PDB entry)
  8. 1336124Domain d2qazc_: 2qaz C: [198300]
    automated match to d2qazd_

Details for d2qazc_

PDB Entry: 2qaz (more details), 2.7 Å

PDB Description: structure of c. crescentus sspb ortholog
PDB Compounds: (C:) SspB Protein

SCOPe Domain Sequences for d2qazc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qazc_ b.136.1.0 (C:) automated matches {Caulobacter vibrioides [TaxId: 155892]}
ppedlmqyeamaqdalrgvvkaalkkaaapgglpephhlyitfktkaagvsgpqdllsky
pdemtivlqhqywdlapgetffsvtlkfggqpkrlsvpyaaltrfydpsvqfalqfsa

SCOPe Domain Coordinates for d2qazc_:

Click to download the PDB-style file with coordinates for d2qazc_.
(The format of our PDB-style files is described here.)

Timeline for d2qazc_: