Class b: All beta proteins [48724] (174 folds) |
Fold b.136: SspB-like [101737] (1 superfamily) core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold |
Superfamily b.136.1: SspB-like [101738] (3 families) |
Family b.136.1.0: automated matches [191484] (1 protein) not a true family |
Protein automated matches [190776] (1 species) not a true protein |
Species Caulobacter vibrioides [TaxId:155892] [188004] (1 PDB entry) |
Domain d2qazc_: 2qaz C: [198300] automated match to d2qazd_ |
PDB Entry: 2qaz (more details), 2.7 Å
SCOPe Domain Sequences for d2qazc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qazc_ b.136.1.0 (C:) automated matches {Caulobacter vibrioides [TaxId: 155892]} ppedlmqyeamaqdalrgvvkaalkkaaapgglpephhlyitfktkaagvsgpqdllsky pdemtivlqhqywdlapgetffsvtlkfggqpkrlsvpyaaltrfydpsvqfalqfsa
Timeline for d2qazc_: