Lineage for d2q87c_ (2q87 C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1519326Domain d2q87c_: 2q87 C: [198291]
    automated match to d2q87b_

Details for d2q87c_

PDB Entry: 2q87 (more details), 1.7 Å

PDB Description: the crystal structure of the human irp60 ectodomain
PDB Compounds: (C:) CMRF35-H antigen

SCOPe Domain Sequences for d2q87c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q87c_ b.1.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvagpvggslsvqcpyekehrtlnkywcrppqiflcdkivetkgsagkrngrvsirdsp
anlsftvtlenlteedagtywcgvdtpwlqdfhdpvvevevsvfpa

SCOPe Domain Coordinates for d2q87c_:

Click to download the PDB-style file with coordinates for d2q87c_.
(The format of our PDB-style files is described here.)

Timeline for d2q87c_: