Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries) |
Domain d2q87a_: 2q87 A: [198290] automated match to d2q87b_ |
PDB Entry: 2q87 (more details), 1.7 Å
SCOPe Domain Sequences for d2q87a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q87a_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} skartvagpvggslsvqcpyekehrtlnkywcrppqiflcdkivetkgsagkrngrvsir dspanlsftvtlenlteedagtywcgvdtpwlqdfhdpvvevevsvf
Timeline for d2q87a_: