| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (23 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries) |
| Domain d2q86a1: 2q86 A:0-110 [198286] Other proteins in same PDB: d2q86b1, d2q86b2, d2q86d1, d2q86d2 automated match to d1tcra1 complexed with nag |
PDB Entry: 2q86 (more details), 1.85 Å
SCOPe Domain Sequences for d2q86a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q86a1 b.1.1.0 (A:0-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ktqveqspqslvvrqgencvlqcnysvtpdnhlrwykqdtgkglvlltvlvdqkdktsng
rysatldkdakhstlhitatllddtatyfcvvgdrgsalfgsgtqlivipy
Timeline for d2q86a1: