![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily) multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer |
![]() | Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) ![]() basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat |
![]() | Family a.204.1.0: automated matches [191410] (1 protein) not a true family |
![]() | Protein automated matches [190562] (4 species) not a true protein |
![]() | Species Vibrio sp. [TaxId:344879] [188224] (3 PDB entries) |
![]() | Domain d2q73b_: 2q73 B: [198280] automated match to d2q73d_ complexed with mg |
PDB Entry: 2q73 (more details), 1.8 Å
SCOPe Domain Sequences for d2q73b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q73b_ a.204.1.0 (B:) automated matches {Vibrio sp. [TaxId: 344879]} efdyapeqsehyffklieevgelsesirkgksgqptldelkgsvaeelydvlyyvcalan ihgvnlekthelkevlnkvk
Timeline for d2q73b_: