Lineage for d1dqll_ (1dql L:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2353665Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353753Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (19 PDB entries)
  8. 2353787Domain d1dqll_: 1dql L: [19828]
    Other proteins in same PDB: d1dqlh_
    part of IgM Fv MEZ

Details for d1dqll_

PDB Entry: 1dql (more details), 2.6 Å

PDB Description: crystal structure of an unliganded (native) fv from a human igm anti- peptide antibody
PDB Compounds: (L:) igm mez immunoglobulin

SCOPe Domain Sequences for d1dqll_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqdirndlgwyqqkpgkapkkliyaasslqsgvps
rfsgsgsgtdftltisslqpedfatyyclqqnsnwtfgqgtkvdik

SCOPe Domain Coordinates for d1dqll_:

Click to download the PDB-style file with coordinates for d1dqll_.
(The format of our PDB-style files is described here.)

Timeline for d1dqll_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dqlh_