SCOP 1.63: Domain d1dqll_: 1dql L:

Lineage for d1dqll_ (1dql L:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fv MEZ (human) IgM, kappa L chain [48763] (1 PDB entry)

8. Domain d1dqll_: 1dql L: [19828]

Details for d1dqll_

PDB Entry: 1dql, 2.6 Å

PDB Description: crystal structure of an unliganded (native) fv from a human igm anti- peptide antibody

SCOP Domain Sequences for d1dqll_:

Sequence; same for both SEQRES and ATOM records:

>d1dqll_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Fv MEZ (human) IgM, kappa L chain}
diqmtqspsslsasvgdrvtitcrasqdirndlgwyqqkpgkapkkliyaasslqsgvps
rfsgsgsgtdftltisslqpedfatyyclqqnsnwtfgqgtkvdik

Timeline for d1dqll_:

• d1dqll_ first appeared (with stable ids) in SCOP 1.55
  
• d1dqll_ appears in SCOP 1.61
  
• d1dqll_ appears in SCOP 1.65
  
• d1dqll_ appears in the current release, SCOPe 2.08