Lineage for d1dqll_ (1dql L:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) 
Species Fv MEZ (human) IgM, kappa L chain [48763] (1 PDB entry) 
Domain d1dqll_: 1dql L: [19828]
Details for d1dqll_
PDB Entry: 1dql (more details), 2.6 Å
PDB Description: crystal structure of an unliganded (native) fv from a human igm anti- peptide antibody
SCOP Domain Sequences for d1dqll_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dqll_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Fv MEZ (human) IgM, kappa L chain}
diqmtqspsslsasvgdrvtitcrasqdirndlgwyqqkpgkapkkliyaasslqsgvps
rfsgsgsgtdftltisslqpedfatyyclqqnsnwtfgqgtkvdik
SCOP Domain Coordinates for d1dqll_:
Click to download the PDB-style file with coordinates for d1dqll_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dqll_:
- d1dqll_ appears in SCOP 1.57
- d1dqll_ appears in the current release, SCOPe 2.08
View in 3D
