Lineage for d2q73a_ (2q73 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1285492Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
    multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer
  4. 1285493Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) (S)
    basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat
  5. 1285571Family a.204.1.0: automated matches [191410] (1 protein)
    not a true family
  6. 1285572Protein automated matches [190562] (4 species)
    not a true protein
  7. 1285590Species Vibrio sp. [TaxId:344879] [188224] (3 PDB entries)
  8. 1285591Domain d2q73a_: 2q73 A: [198279]
    automated match to d2q73d_
    complexed with mg

Details for d2q73a_

PDB Entry: 2q73 (more details), 1.8 Å

PDB Description: Crystal structure of iMazG from Vibrio DAT 722: Ctag-iMazG (P41212)
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2q73a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q73a_ a.204.1.0 (A:) automated matches {Vibrio sp. [TaxId: 344879]}
mklselqshikefdyapeqsehyffklieevgelsesirkgksgqptldelkgsvaeely
dvlyyvcalanihgvnlekthelkevlnkv

SCOPe Domain Coordinates for d2q73a_:

Click to download the PDB-style file with coordinates for d2q73a_.
(The format of our PDB-style files is described here.)

Timeline for d2q73a_: