Lineage for d2q2qf_ (2q2q F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842913Protein automated matches [190085] (59 species)
    not a true protein
  7. 2843396Species Pseudomonas putida [TaxId:303] [188252] (3 PDB entries)
  8. 2843406Domain d2q2qf_: 2q2q F: [198274]
    automated match to d2q2wd_
    complexed with nad

Details for d2q2qf_

PDB Entry: 2q2q (more details), 2.02 Å

PDB Description: structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida
PDB Compounds: (F:) Beta-D-hydroxybutyrate dehydrogenase

SCOPe Domain Sequences for d2q2qf_:

Sequence, based on SEQRES records: (download)

>d2q2qf_ c.2.1.2 (F:) automated matches {Pseudomonas putida [TaxId: 303]}
tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
pgwvltplvqkqiddraanggdplqaqhdllaekqpslafvtpehlgelvlflcseagsq
vrgaawnvdggwlaq

Sequence, based on observed residues (ATOM records): (download)

>d2q2qf_ c.2.1.2 (F:) automated matches {Pseudomonas putida [TaxId: 303]}
tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
pgwvltplaqhdllaekqpslafvtpehlgelvlflcseagsqvrgaawnvdggwlaq

SCOPe Domain Coordinates for d2q2qf_:

Click to download the PDB-style file with coordinates for d2q2qf_.
(The format of our PDB-style files is described here.)

Timeline for d2q2qf_: