Lineage for d1igmh_ (1igm H:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (30 PDB entries)
Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
Domain d1igmh_: 1igm H: [19827]
Other proteins in same PDB: d1igml_
part of IgM Fv POT
Details for d1igmh_
PDB Entry: 1igm (more details), 2.3 Å
PDB Description: three dimensional structure of an fv from a human igm immunoglobulin
PDB Compounds: (H:) igm-kappa pot fv (heavy chain)SCOPe Domain Sequences for d1igmh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igmh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
evhllesggnlvqpggslrlscaasgftfnifvmswvrqapgkglewvsgvfgsggntdy
adavkgrftitrdnskntlylqmnslraedtaiyycakhrvsyvltgfdswgqgtlvtvs
sgsasaptl
SCOPe Domain Coordinates for d1igmh_:
Click to download the PDB-style file with coordinates for d1igmh_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1igmh_:
- d1igmh_ first appeared (with stable ids) in SCOP 1.55
- d1igmh_ appears in SCOPe 2.07
View in 3D
