Lineage for d2py8d_ (2py8 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2351974Fold a.280: RbcX-like [158614] (1 superfamily)
    5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer
  4. 2351975Superfamily a.280.1: RbcX-like [158615] (2 families) (S)
  5. 2351976Family a.280.1.1: RbcX-like [158616] (1 protein)
    Pfam PF02341 (note typo in the Pfam name: RcbX)
  6. 2351977Protein RuBisCo chaperone RbcX [158617] (5 species)
  7. 2352032Species Synechocystis sp. PCC 6803 [TaxId:1148] [158620] (1 PDB entry)
    Uniprot Q55670 4-123
  8. 2352036Domain d2py8d_: 2py8 D: [198264]
    automated match to d2py8a1
    complexed with cl, pe4

Details for d2py8d_

PDB Entry: 2py8 (more details), 2.45 Å

PDB Description: rbcx
PDB Compounds: (D:) Hypothetical protein rbcX

SCOPe Domain Sequences for d2py8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2py8d_ a.280.1.1 (D:) RuBisCo chaperone RbcX {Synechocystis sp. PCC 6803 [TaxId: 1148]}
qtkhiaqatvkvlqsyltyqavlriqselgetnppqaiwlnqylashsiqngetfltell
denkelvlrilavrediaesvldflpgmtrnslaesniahrrh

SCOPe Domain Coordinates for d2py8d_:

Click to download the PDB-style file with coordinates for d2py8d_.
(The format of our PDB-style files is described here.)

Timeline for d2py8d_: