SCOPe 2.05: Domain d2pxwa_: 2pxw A:

Lineage for d2pxwa_ (2pxw A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (20 species)
   not a true protein

7. Species Zoanthus sp. [TaxId:105402] [193832] (8 PDB entries)

8. Domain d2pxwa_: 2pxw A: [198263]
   automated match to d2pxwb_
   mutant

Details for d2pxwa_

PDB Entry: 2pxw, 2.4 Å

PDB Description: crystal structure of n66d mutant of green fluorescent protein from zoanthus sp. at 2.4 a resolution (transition state)

PDB Compounds: (A:) GFP-like fluorescent chromoprotein FP506

SCOPe Domain Sequences for d2pxwa_:

Sequence; same for both SEQRES and ATOM records:

>d2pxwa_ d.22.1.0 (A:) automated matches {Zoanthus sp. [TaxId: 105402]}
skhgltkemtmkyrmegcvdghkfvitgegigypfkgkqainlcvveggplpfaedilsa
afdygdygnrvfteypqdivdyfknscpagytwdrsflfedgavcicnaditvsveencm
yheskfygvnfpadgpvmkkmtdnwepscekiipvpkqgilkgdvsmylllkdggrlrcq
fdtvykaksvprkmpdwhfiqhkltredrsdaknqkwhltehaiasgsalp

Timeline for d2pxwa_:

• d2pxwa_ first appeared in SCOPe 2.03
  
• d2pxwa_ appears in SCOPe 2.04
  
• d2pxwa_ appears in SCOPe 2.06
  
• d2pxwa_ appears in the current release, SCOPe 2.08