SCOPe 2.05: Domain d2puql1: 2puq L:49-86

Lineage for d2puql1 (2puq L:49-86)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (56 PDB entries)
   Uniprot P08709 108-202 ! Uniprot P08709 107-202

8. Domain d2puql1: 2puq L:49-86 [198261]
   Other proteins in same PDB: d2puqh_
   automated match to d1danl1
   complexed with bgc, ca, fuc

Details for d2puql1

PDB Entry: 2puq, 2.05 Å

PDB Description: crystal structure of active site inhibited coagulation factor viia in complex with soluble tissue factor

PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d2puql1:

Sequence; same for both SEQRES and ATOM records:

>d2puql1 g.3.11.1 (L:49-86) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
qcasspcqnggsckdqlqsyicfclpafegrncethkd

Timeline for d2puql1:

• d2puql1 first appeared in SCOPe 2.03
  
• d2puql1 appears in SCOPe 2.04
  
• d2puql1 appears in SCOPe 2.06
  
• d2puql1 appears in the current release, SCOPe 2.08