Lineage for d2puql1 (2puq L:49-86)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1961206Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1961207Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1961216Protein Coagulation factor VIIa [57201] (1 species)
  7. 1961217Species Human (Homo sapiens) [TaxId:9606] [57202] (56 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 1961249Domain d2puql1: 2puq L:49-86 [198261]
    Other proteins in same PDB: d2puqh_
    automated match to d1danl1
    complexed with bgc, ca, fuc

Details for d2puql1

PDB Entry: 2puq (more details), 2.05 Å

PDB Description: crystal structure of active site inhibited coagulation factor viia in complex with soluble tissue factor
PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d2puql1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2puql1 g.3.11.1 (L:49-86) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
qcasspcqnggsckdqlqsyicfclpafegrncethkd

SCOPe Domain Coordinates for d2puql1:

Click to download the PDB-style file with coordinates for d2puql1.
(The format of our PDB-style files is described here.)

Timeline for d2puql1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2puql2
View in 3D
Domains from other chains:
(mouse over for more information)
d2puqh_