Lineage for d1igml_ (1igm L:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653053Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (18 PDB entries)
  8. 653077Domain d1igml_: 1igm L: [19826]
    Other proteins in same PDB: d1igmh_
    part of IgM Fv POT

Details for d1igml_

PDB Entry: 1igm (more details), 2.3 Å

PDB Description: three dimensional structure of an fv from a human igm immunoglobulin
PDB Compounds: (L:) igm-kappa pot fv (light chain)

SCOP Domain Sequences for d1igml_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igml_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcqasqdisnylawyqqkpgkapelriydasnletgvps
rfsgsgsgtdftftisslqpediatyycqqyqnlpltfgpgtkvdikrtvaapsv

SCOP Domain Coordinates for d1igml_:

Click to download the PDB-style file with coordinates for d1igml_.
(The format of our PDB-style files is described here.)

Timeline for d1igml_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1igmh_