SCOP 1.63: Domain d1igml_: 1igm L:

Lineage for d1igml_ (1igm L:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fv POT (human) IgM, kappa L chain [48762] (1 PDB entry)

8. Domain d1igml_: 1igm L: [19826]

Details for d1igml_

PDB Entry: 1igm, 2.3 Å

PDB Description: three dimensional structure of an fv from a human igm immunoglobulin

SCOP Domain Sequences for d1igml_:

Sequence; same for both SEQRES and ATOM records:

>d1igml_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Fv POT (human) IgM, kappa L chain}
diqmtqspsslsasvgdrvtitcqasqdisnylawyqqkpgkapelriydasnletgvps
rfsgsgsgtdftftisslqpediatyycqqyqnlpltfgpgtkvdikrtvaapsv

Timeline for d1igml_:

• d1igml_ first appeared (with stable ids) in SCOP 1.55
  
• d1igml_ appears in SCOP 1.61
  
• d1igml_ appears in SCOP 1.65
  
• d1igml_ appears in the current release, SCOPe 2.08