SCOPe 2.06: Domain d2pocc_: 2poc C:

Lineage for d2pocc_ (2poc C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.80: SIS domain [53696] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.80.1: SIS domain [53697] (4 families)

5. Family c.80.1.0: automated matches [191405] (1 protein)
   not a true family

6. Protein automated matches [190547] (15 species)
   not a true protein

7. Species Candida albicans [TaxId:237561] [194423] (4 PDB entries)

8. Domain d2pocc_: 2poc C: [198258]
   automated match to d2pocd_
   complexed with act, bg6, na, ud1

Details for d2pocc_

PDB Entry: 2poc, 1.8 Å

PDB Description: the crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans

PDB Compounds: (C:) isomerase domain of glutamine-fructose-6-phosphate transaminase (isomerizing)

SCOPe Domain Sequences for d2pocc_:

Sequence; same for both SEQRES and ATOM records:

>d2pocc_ c.80.1.0 (C:) automated matches {Candida albicans [TaxId: 237561]}
pykhfmqkeifeqpdsafntmrgridfencvvtlgglkswlstirrcrriimiacgtsyh
sclatrsifeelteipvsvelasdfldrrspvfrddtcvfvsqsgetadsilalqycler
galtvgivnsvgssmsrqthcgvhinagpeigvastkaytsqyialvmfalslsndsisr
kgrheeiikglqkipeqikqvlklenkikdlcnsslndqksllllgrgyqfatalegalk
ikeisymhsegvlagelkhgilalvdedlpiiafatrdslfpkvmsaieqvtardgrpiv
icnegdaiisndkvhttlevpetvdclqgllnviplqlisywlavnrgidvd

Timeline for d2pocc_:

• d2pocc_ first appeared in SCOPe 2.03
  
• d2pocc_ appears in SCOPe 2.05
  
• d2pocc_ appears in SCOPe 2.07
  
• d2pocc_ appears in the current release, SCOPe 2.08