Lineage for d2poca_ (2poc A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140444Family c.80.1.0: automated matches [191405] (1 protein)
    not a true family
  6. 2140445Protein automated matches [190547] (14 species)
    not a true protein
  7. 2140464Species Candida albicans [TaxId:237561] [194423] (4 PDB entries)
  8. 2140465Domain d2poca_: 2poc A: [198256]
    automated match to d2pocd_
    complexed with act, bg6, na, ud1

Details for d2poca_

PDB Entry: 2poc (more details), 1.8 Å

PDB Description: the crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans
PDB Compounds: (A:) isomerase domain of glutamine-fructose-6-phosphate transaminase (isomerizing)

SCOPe Domain Sequences for d2poca_:

Sequence, based on SEQRES records: (download)

>d2poca_ c.80.1.0 (A:) automated matches {Candida albicans [TaxId: 237561]}
gpykhfmqkeifeqpdsafntmrgridfencvvtlgglkswlstirrcrriimiacgtsy
hsclatrsifeelteipvsvelasdfldrrspvfrddtcvfvsqsgetadsilalqycle
rgaltvgivnsvgssmsrqthcgvhinagpeigvastkaytsqyialvmfalslsndsis
rkgrheeiikglqkipeqikqvlklenkikdlcnsslndqksllllgrgyqfatalegal
kikeisymhsegvlagelkhgilalvdedlpiiafatrdslfpkvmsaieqvtardgrpi
vicnegdaiisndkvhttlevpetvdclqgllnviplqlisywlavnrgidvd

Sequence, based on observed residues (ATOM records): (download)

>d2poca_ c.80.1.0 (A:) automated matches {Candida albicans [TaxId: 237561]}
gpykhfmqkeifeqpdsafntmrgridfencvvtlgglkswlstirrcrriimiacgtsy
hsclatrsifeelteipvsvelasdfldrrspvfrddtcvfvsqsgetadsilalqycle
rgaltvgivnsvgssmsrqthcgvhinagpeigvastkaytsqyialvmfalslsndsis
rkgrheeiikglqkipeqikqvlklenkikdlcnsslndqksllllgrgyqfatalegal
kikeisymhsegvlagellpiiafatrdslfpkvmsaieqvtardgrpivicnegdaiis
vhttlevpetvdclqgllnviplqlisywlavnrgidvd

SCOPe Domain Coordinates for d2poca_:

Click to download the PDB-style file with coordinates for d2poca_.
(The format of our PDB-style files is described here.)

Timeline for d2poca_: