Lineage for d2pina_ (2pin A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009325Protein Thyroid hormone receptor beta (TR-beta) [48530] (1 species)
  7. 2009326Species Human (Homo sapiens) [TaxId:9606] [48531] (16 PDB entries)
    Uniprot P10828 202-460
  8. 2009332Domain d2pina_: 2pin A: [198255]
    automated match to d2pinb_
    complexed with 4hy, leg, so4

Details for d2pina_

PDB Entry: 2pin (more details), 2.3 Å

PDB Description: thyroid receptor beta in complex with inhibitor
PDB Compounds: (A:) Thyroid hormone receptor Beta-1

SCOPe Domain Sequences for d2pina_:

Sequence, based on SEQRES records: (download)

>d2pina_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]}
hkpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqapivnapeggkvdleaf
shftkiitpaitrvvdfakklpmfcelpcedqiillkgccmeimslraavrydpesetlt
lngemavtrgqlkngglgvvsdaifrlgmslssfnlddtevallqavllmssdrpglacv
eriekyqdsfllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflhmkvecpte
lfpplflevfe

Sequence, based on observed residues (ATOM records): (download)

>d2pina_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]}
hkpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqapggkvdleafshftki
itpaitrvvdfakklpmfcelpcedqiillkgccmeimslraavrydpesetltlngema
vtrgqlkngglgvvsdaifrlgmslssfnlddtevallqavllmssdrpglacverieky
qdsfllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflhmkvecptelfpplf
levfe

SCOPe Domain Coordinates for d2pina_:

Click to download the PDB-style file with coordinates for d2pina_.
(The format of our PDB-style files is described here.)

Timeline for d2pina_: