Lineage for d1mak__ (1mak -)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) 
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) 
Species Fab 26-10 (mouse), kappa L chain [48761] (4 PDB entries) 
Domain d1mak__: 1mak - [19825]
Details for d1mak__
PDB Entry: 1mak (more details)
PDB Description: solution structure of an isolated antibody vl domain
SCOP Domain Sequences for d1mak__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mak__ b.1.1.1 (-) Immunoglobulin (variable domains of L and H chains) {Fab 26-10 (mouse), kappa L chain}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylnwylqkagqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqtthvpptfgggtkleikr
SCOP Domain Coordinates for d1mak__:
Click to download the PDB-style file with coordinates for d1mak__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mak__:
- d1mak__ first appeared (with stable ids) in SCOP 1.55
- d1mak__ appears in SCOP 1.59
- d1mak__ appears in SCOP 1.63
- d1mak__ appears in the current release, SCOPe 2.08, called d1maka_
View in 3D