Lineage for d2p9sb_ (2p9s B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2883385Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2883667Protein Actin-related protein 2, Arp2 [69530] (1 species)
    part of Arp2/3 complex
  7. 2883668Species Cow (Bos taurus) [TaxId:9913] [69531] (14 PDB entries)
    Uniprot P61160 143-350 # 100% sequence identity
  8. 2883674Domain d2p9sb_: 2p9s B: [198248]
    Other proteins in same PDB: d2p9sa1, d2p9sa2, d2p9sc_, d2p9sd1, d2p9sd2, d2p9se_, d2p9sf_, d2p9sg_
    automated match to d1u2vb1
    complexed with atp, mg

Details for d2p9sb_

PDB Entry: 2p9s (more details), 2.68 Å

PDB Description: Structure of bovine Arp2/3 complex co-crystallized with ATP/Mg2+
PDB Compounds: (B:) actin-like protein 2

SCOPe Domain Sequences for d2p9sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p9sb_ c.55.1.1 (B:) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]}
tgvvvdsgdgvthicpvyegfslphltrrldiagrditrylikllllrgyafnhsadfet
vrmikeklcyvgynieqeqklalettvlvesytlpdgriikvggerfeapealfqphlin
vegvgvaellfntiqaadidtrsefykhivlsggstmypglpsrlerelkqlylervlkg
dveklskfkiriedppr

SCOPe Domain Coordinates for d2p9sb_:

Click to download the PDB-style file with coordinates for d2p9sb_.
(The format of our PDB-style files is described here.)

Timeline for d2p9sb_: