| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
| Protein Actin-related protein 2, Arp2 [69530] (1 species) part of Arp2/3 complex |
| Species Cow (Bos taurus) [TaxId:9913] [69531] (14 PDB entries) Uniprot P61160 143-350 # 100% sequence identity |
| Domain d2p9nb_: 2p9n B: [198246] Other proteins in same PDB: d2p9na1, d2p9na2, d2p9nc_, d2p9nd1, d2p9nd2, d2p9ne_, d2p9nf_, d2p9ng_ automated match to d1u2vb1 complexed with adp, ca |
PDB Entry: 2p9n (more details), 2.85 Å
SCOPe Domain Sequences for d2p9nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p9nb_ c.55.1.1 (B:) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]}
qavltlyaqglltgvvvdsgdgvthicpvyegfslphltrrldiagrditrylikllllr
gyafnhsadfetvrmikeklcyvgynieqeqklalettvlvesytlpdgriikvggerfe
apealfqphlinvegvgvaellfntiqaadidtrsefykhivlsggstmypglpsrlere
lkqlylervlkgdveklskfkir
Timeline for d2p9nb_: