Lineage for d2p9mb_ (2p9m B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2167405Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2167406Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2167576Family d.37.1.0: automated matches [191603] (1 protein)
    not a true family
  6. 2167577Protein automated matches [191100] (14 species)
    not a true protein
  7. 2167623Species Methanocaldococcus jannaschii [TaxId:243232] [194300] (1 PDB entry)
  8. 2167625Domain d2p9mb_: 2p9m B: [198244]
    automated match to d2p9md_

Details for d2p9mb_

PDB Entry: 2p9m (more details), 2.59 Å

PDB Description: crystal structure of conserved hypothetical protein mj0922 from methanocaldococcus jannaschii dsm 2661
PDB Compounds: (B:) Hypothetical protein MJ0922

SCOPe Domain Sequences for d2p9mb_:

Sequence, based on SEQRES records: (download)

>d2p9mb_ d.37.1.0 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
dtlknikvkdvmtknvitakrhegvveafekmlkykisslpviddenkvigivtttdigy
nlirdkytlettigdvmtkdvitihedasileaikkmdisgkkeeiinqlpvvdknnklv
giisdgdiirtiski

Sequence, based on observed residues (ATOM records): (download)

>d2p9mb_ d.37.1.0 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
dtlknikvkdvmtknvitakrhegvveafekmlkykisslpviddenkvigivtttdigy
nlirdkytlettigdvmtkdvitihedasileaikkmdiiinqlpvvdknnklvgiisdg
diirtiski

SCOPe Domain Coordinates for d2p9mb_:

Click to download the PDB-style file with coordinates for d2p9mb_.
(The format of our PDB-style files is described here.)

Timeline for d2p9mb_: