SCOP 1.69: Domain d1maj__: 1maj -

Lineage for d1maj__ (1maj -)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (126 PDB entries)

8. Domain d1maj__: 1maj - [19824]
   VL of antibody 26-10 only !SQ P01642 21-115 #! KV2G_MOUSE IG KAPPA CHAIN V-II REGION 26-10

Details for d1maj__

PDB Entry: 1maj

PDB Description: solution structure of an isolated antibody vl domain

SCOP Domain Sequences for d1maj__:

Sequence; same for both SEQRES and ATOM records:

>d1maj__ b.1.1.1 (-) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylnwylqkagqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqtthvpptfgggtkleikr

Timeline for d1maj__:

• d1maj__ first appeared (with stable ids) in SCOP 1.55
  
• d1maj__ appears in SCOP 1.67
  
• d1maj__ appears in SCOP 1.71
  
• d1maj__ appears in the current release, SCOPe 2.08, called d1maja_