Lineage for d1maj__ (1maj -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52034Species Fab 26-10 (mouse), kappa L chain [48761] (4 PDB entries)
  8. 52041Domain d1maj__: 1maj - [19824]

Details for d1maj__

PDB Entry: 1maj (more details)

PDB Description: solution structure of an isolated antibody vl domain
PDB Compounds: ( :)

SCOP Domain Sequences for d1maj__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1maj__ b.1.1.1 (-) Immunoglobulin (variable domains of L and H chains) {Fab 26-10 (mouse), kappa L chain}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylnwylqkagqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqtthvpptfgggtkleikr

SCOP Domain Coordinates for d1maj__:

Click to download the PDB-style file with coordinates for d1maj__.
(The format of our PDB-style files is described here.)

Timeline for d1maj__: