Lineage for d2oz4l2 (2oz4 L:108-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752822Domain d2oz4l2: 2oz4 L:108-214 [198230]
    Other proteins in same PDB: d2oz4a1, d2oz4a2, d2oz4a3, d2oz4h_, d2oz4l1
    automated match to d1dqdl2
    complexed with nag, so4, trs, zn

Details for d2oz4l2

PDB Entry: 2oz4 (more details), 2.7 Å

PDB Description: structural plasticity in igsf domain 4 of icam-1 mediates cell surface dimerization
PDB Compounds: (L:) Fab fragment light chain

SCOPe Domain Sequences for d2oz4l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oz4l2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d2oz4l2:

Click to download the PDB-style file with coordinates for d2oz4l2.
(The format of our PDB-style files is described here.)

Timeline for d2oz4l2: