SCOPe 2.06: Domain d2oxqc_: 2oxq C:

Lineage for d2oxqc_ (2oxq C:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.2: U-box [90222] (5 proteins)
   Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues

6. Protein automated matches [190212] (2 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [225070] (2 PDB entries)

8. Domain d2oxqc_: 2oxq C: [198227]
   Other proteins in same PDB: d2oxqa1, d2oxqa2, d2oxqb1, d2oxqb2
   automated match to d2c2vs1
   complexed with cl

Details for d2oxqc_

PDB Entry: 2oxq, 2.9 Å

PDB Description: Structure of the UbcH5 :CHIP U-box complex

PDB Compounds: (C:) STIP1 homology and U-Box containing protein 1

SCOPe Domain Sequences for d2oxqc_:

Sequence; same for both SEQRES and ATOM records:

>d2oxqc_ g.44.1.2 (C:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
eipdylcgkisfelmaepcitpsgitydrkdieehlqrvghfdpvtrspltqdqlipnla
mkevidafiqen

Timeline for d2oxqc_:

• d2oxqc_ first appeared in SCOPe 2.03
  
• d2oxqc_ appears in SCOPe 2.05
  
• d2oxqc_ appears in SCOPe 2.07
  
• d2oxqc_ appears in the current release, SCOPe 2.08