| Class g: Small proteins [56992] (94 folds) |
| Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
| Family g.44.1.2: U-box [90222] (5 proteins) Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues |
| Protein automated matches [190212] (2 species) not a true protein |
| Species Zebrafish (Danio rerio) [TaxId:7955] [225070] (2 PDB entries) |
| Domain d2oxqc_: 2oxq C: [198227] Other proteins in same PDB: d2oxqa1, d2oxqa2, d2oxqb1, d2oxqb2 automated match to d2c2vs1 complexed with cl |
PDB Entry: 2oxq (more details), 2.9 Å
SCOPe Domain Sequences for d2oxqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oxqc_ g.44.1.2 (C:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
eipdylcgkisfelmaepcitpsgitydrkdieehlqrvghfdpvtrspltqdqlipnla
mkevidafiqen
Timeline for d2oxqc_: