Lineage for d1igil1 (1igi L:1-107)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7370Species Fab 26-10 (mouse), kappa L chain [48761] (4 PDB entries)
  8. 7376Domain d1igil1: 1igi L:1-107 [19822]
    Other proteins in same PDB: d1igih2, d1igil2

Details for d1igil1

PDB Entry: 1igi (more details), 2.7 Å

PDB Description: 26-10 fab:digoxin complex-affinity and specificity due to surface complementarity
PDB Compounds: (L:)

SCOP Domain Sequences for d1igil1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igil1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab 26-10 (mouse), kappa L chain}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylnwylqkagqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqtthvpptfgggtkleik

SCOP Domain Coordinates for d1igil1:

Click to download the PDB-style file with coordinates for d1igil1.
(The format of our PDB-style files is described here.)

Timeline for d1igil1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1igil2