SCOPe 2.08: Domain d2orbm1: 2orb M:1-107

Lineage for d2orbm1 (2orb M:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d2orbm1: 2orb M:1-107 [198219]
   Other proteins in same PDB: d2orbl2, d2orbm2
   automated match to d1h0da1
   complexed with so4

Details for d2orbm1

PDB Entry: 2orb, 2.2 Å

PDB Description: The structure of the anti-c-myc antibody 9E10 Fab fragment

PDB Compounds: (M:) Monoclonal anti-c-myc antibody 9E10

SCOPe Domain Sequences for d2orbm1:

Sequence, based on SEQRES records:

>d2orbm1 b.1.1.1 (M:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaslavslgqratiscrasesvdnygfsfmnwfqqkpgqppklliyaisnrgs
gvparfsgsgsgtdfslnihpveeddpamyfcqqtkevpwtfgggtkleik

Sequence, based on observed residues (ATOM records):

>d2orbm1 b.1.1.1 (M:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaslavslgqratiscrasesvdmnwfqqkpgqppklliyaisnrgsgvparf
sgsgsgtdfslnihpveeddpamyfcqqtevpwtfgggtkleik

Timeline for d2orbm1:

• d2orbm1 first appeared in SCOPe 2.03
  
• d2orbm1 appears in SCOPe 2.07