Lineage for d2oqta1 (2oqt A:1-151)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971248Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily)
    beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossing
  4. 2971249Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (3 families) (S)
  5. 2971287Family d.112.1.0: automated matches [191530] (1 protein)
    not a true family
  6. 2971288Protein automated matches [190899] (6 species)
    not a true protein
  7. 2971299Species Streptococcus pyogenes [TaxId:301447] [193212] (1 PDB entry)
  8. 2971300Domain d2oqta1: 2oqt A:1-151 [198214]
    Other proteins in same PDB: d2oqta2, d2oqtb2, d2oqtc2, d2oqtd2
    automated match to d2oqtd_

Details for d2oqta1

PDB Entry: 2oqt (more details), 2.41 Å

PDB Description: Structural Genomics, the crystal structure of a putative PTS IIA domain from Streptococcus pyogenes M1 GAS
PDB Compounds: (A:) Hypothetical protein SPy0176

SCOPe Domain Sequences for d2oqta1:

Sequence, based on SEQRES records: (download)

>d2oqta1 d.112.1.0 (A:1-151) automated matches {Streptococcus pyogenes [TaxId: 301447]}
mnlkqalidnnsirlglsadtwqeavrlavqplidskavtsayydaiiastekygpyyvl
mpgmamphaeaglgvnrnafalitltkpvtfsdgkevsvlltlaatdpsihttvaipqiv
alfeldnaierlvacqspkevlemveeskds

Sequence, based on observed residues (ATOM records): (download)

>d2oqta1 d.112.1.0 (A:1-151) automated matches {Streptococcus pyogenes [TaxId: 301447]}
mnlkqalidnnsirlglsadtwqeavrlavqplidskavtsayydaiiastekygpyyvl
mpgmamphaealgvnrnafalitltkpvtfsdgkevsvlltlaatdpsihttvaipqiva
lfeldnaierlvacqspkevlemveeskds

SCOPe Domain Coordinates for d2oqta1:

Click to download the PDB-style file with coordinates for d2oqta1.
(The format of our PDB-style files is described here.)

Timeline for d2oqta1: