![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
![]() | Protein automated matches [190396] (40 species) not a true protein |
![]() | Species Hiv-1 m:b_hxb2r [TaxId:11706] [225268] (21 PDB entries) |
![]() | Domain d2opra2: 2opr A:430-548 [198211] Other proteins in same PDB: d2opra1, d2oprb_ automated match to d1rtda1 complexed with hbq; mutant |
PDB Entry: 2opr (more details), 2.9 Å
SCOPe Domain Sequences for d2opra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2opra2 c.55.3.0 (A:430-548) automated matches {Hiv-1 m:b_hxb2r [TaxId: 11706]} ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqv
Timeline for d2opra2: