Lineage for d2opqa2 (2opq A:430-537)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2462855Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2464026Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2464027Protein automated matches [190396] (36 species)
    not a true protein
  7. 2464091Species Hiv-1 m:b_hxb2r [TaxId:11706] [225268] (21 PDB entries)
  8. 2464109Domain d2opqa2: 2opq A:430-537 [198209]
    Other proteins in same PDB: d2opqa1, d2opqb_
    automated match to d1vrta1
    complexed with hbq, po4; mutant

Details for d2opqa2

PDB Entry: 2opq (more details), 2.8 Å

PDB Description: Crystal Structure of L100I Mutant HIV-1 Reverse Transcriptase in Complex with GW420867X.
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d2opqa2:

Sequence, based on SEQRES records: (download)

>d2opqa2 c.55.3.0 (A:430-537) automated matches {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvp

Sequence, based on observed residues (ATOM records): (download)

>d2opqa2 c.55.3.0 (A:430-537) automated matches {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ekepivgaetfyvdagyvtnrgrqkvvtltdttnqktelqaiylalqdsglevnivtdsq
yalgiiqaqpdqseselvnqiieqlikkekvylawvp

SCOPe Domain Coordinates for d2opqa2:

Click to download the PDB-style file with coordinates for d2opqa2.
(The format of our PDB-style files is described here.)

Timeline for d2opqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2opqa1
View in 3D
Domains from other chains:
(mouse over for more information)
d2opqb_