SCOPe 2.07: Domain d2o5ib2: 2o5i B:50-172

Lineage for d2o5ib2 (2o5i B:50-172)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
   unusual fold; contains a left-handed beta-alpha-beta unit

4. Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)
   automatically mapped to Pfam PF01000

5. Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins)

6. Protein RNA polymerase alpha subunit [56555] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75595] (16 PDB entries)
   Uniprot Q9Z9H6; part of multichain biological unit

8. Domain d2o5ib2: 2o5i B:50-172 [198194]
   Other proteins in same PDB: d2o5ia1, d2o5ib1, d2o5ic_, d2o5id_, d2o5ie_, d2o5ik1, d2o5il1, d2o5im_, d2o5in_, d2o5io_
   automated match to d1smya2
   protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2o5ib2

PDB Entry: 2o5i, 2.5 Å

PDB Description: Crystal structure of the T. thermophilus RNA polymerase elongation complex

PDB Compounds: (B:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d2o5ib2:

Sequence; same for both SEQRES and ATOM records:

>d2o5ib2 d.181.1.1 (B:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

Timeline for d2o5ib2:

• d2o5ib2 first appeared in SCOPe 2.03
  
• d2o5ib2 appears in SCOPe 2.06
  
• d2o5ib2 appears in the current release, SCOPe 2.08