Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit |
Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) automatically mapped to Pfam PF01000 |
Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins) |
Protein RNA polymerase alpha subunit [56555] (3 species) |
Species Thermus thermophilus [TaxId:274] [75595] (16 PDB entries) Uniprot Q9Z9H6; part of multichain biological unit |
Domain d2o5ib2: 2o5i B:50-172 [198194] Other proteins in same PDB: d2o5ia1, d2o5ib1, d2o5ic_, d2o5id_, d2o5ie_, d2o5ik1, d2o5il1, d2o5im_, d2o5in_, d2o5io_ automated match to d1smya2 protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 2o5i (more details), 2.5 Å
SCOPe Domain Sequences for d2o5ib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o5ib2 d.181.1.1 (B:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]} gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda vfs
Timeline for d2o5ib2: