Lineage for d1igjb1 (1igj B:2-114)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219425Species Fab 26-10 (mouse), kappa L chain [48761] (4 PDB entries)
  8. 219427Domain d1igjb1: 1igj B:2-114 [19819]
    Other proteins in same PDB: d1igja2, d1igjb2, d1igjc2, d1igjd2

Details for d1igjb1

PDB Entry: 1igj (more details), 2.5 Å

PDB Description: 26-10 fab:digoxin complex-affinity and specificity due to surface complementarity

SCOP Domain Sequences for d1igjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igjb1 b.1.1.1 (B:2-114) Immunoglobulin (variable domains of L and H chains) {Fab 26-10 (mouse), kappa L chain}
vqlqqsgpelvkpgasvrmsckssgyiftdfymnwvrqshgksldyigyispysgvtgyn
qkfkgkatltvdkssstaymelrsltsedsavyycagssgnkwamdywghgasvtvssa

SCOP Domain Coordinates for d1igjb1:

Click to download the PDB-style file with coordinates for d1igjb1.
(The format of our PDB-style files is described here.)

Timeline for d1igjb1: