| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
| Species Fab 26-10 (mouse), kappa L chain [48761] (4 PDB entries) |
| Domain d1igjb1: 1igj B:2-114 [19819] Other proteins in same PDB: d1igja2, d1igjb2, d1igjc2, d1igjd2 |
PDB Entry: 1igj (more details), 2.5 Å
SCOP Domain Sequences for d1igjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igjb1 b.1.1.1 (B:2-114) Immunoglobulin (variable domains of L and H chains) {Fab 26-10 (mouse), kappa L chain}
vqlqqsgpelvkpgasvrmsckssgyiftdfymnwvrqshgksldyigyispysgvtgyn
qkfkgkatltvdkssstaymelrsltsedsavyycagssgnkwamdywghgasvtvssa
Timeline for d1igjb1: