SCOP 1.55: Domain d1igjb1: 1igj B:2-114

Lineage for d1igjb1 (1igj B:2-114)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab 26-10 (mouse), kappa L chain [48761] (4 PDB entries)

8. Domain d1igjb1: 1igj B:2-114 [19819]
   Other proteins in same PDB: d1igja2, d1igjb2, d1igjc2, d1igjd2

Details for d1igjb1

PDB Entry: 1igj, 2.5 Å

PDB Description: 26-10 fab:digoxin complex-affinity and specificity due to surface complementarity

SCOP Domain Sequences for d1igjb1:

Sequence; same for both SEQRES and ATOM records:

>d1igjb1 b.1.1.1 (B:2-114) Immunoglobulin (variable domains of L and H chains) {Fab 26-10 (mouse), kappa L chain}
vqlqqsgpelvkpgasvrmsckssgyiftdfymnwvrqshgksldyigyispysgvtgyn
qkfkgkatltvdkssstaymelrsltsedsavyycagssgnkwamdywghgasvtvssa

Timeline for d1igjb1:

• d1igjb1 appears in SCOP 1.57
  
• d1igjb1 appears in the current release, SCOPe 2.08