| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d2nr6e1: 2nr6 E:1-107 [198181] Other proteins in same PDB: d2nr6a1, d2nr6a2, d2nr6b1, d2nr6b2, d2nr6c2, d2nr6d_, d2nr6e2, d2nr6f_ automated match to d1c12a1 complexed with nag, zn |
PDB Entry: 2nr6 (more details), 2.81 Å
SCOPe Domain Sequences for d2nr6e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nr6e1 b.1.1.0 (E:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqshkfmstsvgdrvsitckasqivstavawyqqkpgqspklliysasyrytgvpd
rftgsgsgtdftftissvqaedlavyycqqhynspqtfgggtkleik
Timeline for d2nr6e1: