Lineage for d2nr6e1 (2nr6 E:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760665Domain d2nr6e1: 2nr6 E:1-107 [198181]
    Other proteins in same PDB: d2nr6a1, d2nr6a2, d2nr6b1, d2nr6b2, d2nr6c2, d2nr6d_, d2nr6e2, d2nr6f_
    automated match to d1c12a1
    complexed with nag, zn

Details for d2nr6e1

PDB Entry: 2nr6 (more details), 2.81 Å

PDB Description: crystal structure of the complex of antibody and the allergen bla g 2
PDB Compounds: (E:) Antibody Light Chain

SCOPe Domain Sequences for d2nr6e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nr6e1 b.1.1.0 (E:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqshkfmstsvgdrvsitckasqivstavawyqqkpgqspklliysasyrytgvpd
rftgsgsgtdftftissvqaedlavyycqqhynspqtfgggtkleik

SCOPe Domain Coordinates for d2nr6e1:

Click to download the PDB-style file with coordinates for d2nr6e1.
(The format of our PDB-style files is described here.)

Timeline for d2nr6e1: