SCOPe 2.08: Domain d2nr6c2: 2nr6 C:108-211

Lineage for d2nr6c2 (2nr6 C:108-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d2nr6c2: 2nr6 C:108-211 [198180]
   Other proteins in same PDB: d2nr6a1, d2nr6a2, d2nr6b1, d2nr6b2, d2nr6c1, d2nr6d_, d2nr6e1, d2nr6f_
   automated match to d1c12a2
   complexed with nag, zn

Details for d2nr6c2

PDB Entry: 2nr6, 2.81 Å

PDB Description: crystal structure of the complex of antibody and the allergen bla g 2

PDB Compounds: (C:) Antibody Light Chain

SCOPe Domain Sequences for d2nr6c2:

Sequence; same for both SEQRES and ATOM records:

>d2nr6c2 b.1.1.2 (C:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d2nr6c2:

• d2nr6c2 first appeared in SCOPe 2.03
  
• d2nr6c2 appears in SCOPe 2.07