SCOPe 2.08: Domain d2nr6c1: 2nr6 C:1-107

Lineage for d2nr6c1 (2nr6 C:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d2nr6c1: 2nr6 C:1-107 [198179]
   Other proteins in same PDB: d2nr6a1, d2nr6a2, d2nr6b1, d2nr6b2, d2nr6c2, d2nr6d_, d2nr6e2, d2nr6f_
   automated match to d1c12a1
   complexed with nag, zn

Details for d2nr6c1

PDB Entry: 2nr6, 2.81 Å

PDB Description: crystal structure of the complex of antibody and the allergen bla g 2

PDB Compounds: (C:) Antibody Light Chain

SCOPe Domain Sequences for d2nr6c1:

Sequence; same for both SEQRES and ATOM records:

>d2nr6c1 b.1.1.0 (C:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqshkfmstsvgdrvsitckasqivstavawyqqkpgqspklliysasyrytgvpd
rftgsgsgtdftftissvqaedlavyycqqhynspqtfgggtkleik

Timeline for d2nr6c1:

• d2nr6c1 first appeared in SCOPe 2.03
  
• d2nr6c1 appears in SCOPe 2.07